PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_019405-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family WRKY
Protein Properties Length: 608aa    MW: 66784.5 Da    PI: 5.7111
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_019405-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY89.23.5e-28297354259
                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    +DgynWrKYGqK+vk++e +rsYYrCt+++C++kkkve++++ ++v+ei+Y+g+Hnh+
  NNU_019405-RA 297 NDGYNWRKYGQKQVKSTESSRSYYRCTYSDCHAKKKVECCDHSGHVTEIIYKGRHNHD 354
                    8********************************************************7 PP

2WRKY1062e-33471527359
                    -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    Dgy+WrKYGqK+vkg+++prsYY+CtsagCpv+k+vers++d+++v+itYeg+H+h+
  NNU_019405-RA 471 DGYRWRKYGQKMVKGNPYPRSYYKCTSAGCPVRKHVERSTDDTSAVIITYEGKHDHD 527
                    9*******************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.804.9E-25283356IPR003657WRKY domain
SuperFamilySSF1182901.96E-23294356IPR003657WRKY domain
SMARTSM007743.1E-29296355IPR003657WRKY domain
PROSITE profilePS5081121.838297356IPR003657WRKY domain
PfamPF031064.3E-21297354IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.6E-35454529IPR003657WRKY domain
SuperFamilySSF1182907.59E-29463529IPR003657WRKY domain
PROSITE profilePS5081135.358464529IPR003657WRKY domain
SMARTSM007741.0E-38469528IPR003657WRKY domain
PfamPF031064.7E-26471526IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 608 aa     Download sequence    Send to blast
MPSLASFKNL FISSIEAETK DENRFTCTKP VSDIENRPKP VLFSANRKAF MADDQGLKAP  60
KEERVTEEVE QIEESEEESE EDEEEGEESE EEKPLPKLQE SSLTVSVPDR SSLEAELRDQ  120
SSQSETLVVP PSIRSSKNDH DPDCRTFSQL LAGAMASPVA NSTAAFSDGL DVKPMISTVH  180
VDSSGFPMVC SPVSLDPAGF KGQFGMSHQE ALASVTAQAA QAQVQKQLQA GFPSSSSELS  240
STSLTQSMPS EPSSTPQEQK VSPVPKDTDV CTPELDKQKS SDQKAKSTHV VMKAPSNDGY  300
NWRKYGQKQV KSTESSRSYY RCTYSDCHAK KKVECCDHSG HVTEIIYKGR HNHDPPRKIR  360
CTKARKSASA VEPDEDSETI DLPVRKLESD PSTPKKELRE VTLSTPEKKR PISSASDGGA  420
GLKTEEEHID EPDAKRRIKD SDTEYSAPLF KTVKEPKIVV QAASDVGISG DGYRWRKYGQ  480
KMVKGNPYPR SYYKCTSAGC PVRKHVERST DDTSAVIITY EGKHDHDMPV PKKRHGPPSA  540
ALLIAAAAAM NNAQIKKAET LPNRRASTQW SMDIDSDLAG EKALELGGEK ALESARTLLS  600
IGIELKPY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A5e-31297529274WRKY transcription factor 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010275819.10.0PREDICTED: probable WRKY transcription factor 32 isoform X1
TrEMBLD7U1A81e-160D7U1A8_VITVI; Putative uncharacterized protein
STRINGVIT_11s0037g00150.t011e-159(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G30935.12e-96WRKY DNA-binding protein 32